(data stored in ACNUC27125 zone)

EMBL: CP000828.PE465

CP000828.PE465       Location/Qualifiers
FT   CDS             complement(479464..480159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0503"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25556"
FT                   /db_xref="GOA:B0CC14"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="InterPro:IPR018011"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC14"
FT                   /protein_id="ABW25556.1"
FT                   /translation="MIRTTRKLDDLSTQLTIPSLVYQGVSRTFLKAFPAVPSKYRYNIT
FT                   ICNEKRFLWFRVAKVGTRSIFNLFEKSDLVLDAEYPYWCHYPLGVYQNYFKFAFVRNPW
FT                   DRLVSCWLNKVVNSNHFGFSESTLSKMQNFDYFIQYLDDLDLDNCDNHIRRQSKLIDLN
FT                   NLNFIGRFESFEEDLLKVADILKIDQVEIQKKNSSKDRNNYKNYYTPELADKVADLYKI
FT                   DINLFSYQY"
     MIRTTRKLDD LSTQLTIPSL VYQGVSRTFL KAFPAVPSKY RYNITICNEK RFLWFRVAKV        60
     GTRSIFNLFE KSDLVLDAEY PYWCHYPLGV YQNYFKFAFV RNPWDRLVSC WLNKVVNSNH       120
     FGFSESTLSK MQNFDYFIQY LDDLDLDNCD NHIRRQSKLI DLNNLNFIGR FESFEEDLLK       180
     VADILKIDQV EIQKKNSSKD RNNYKNYYTP ELADKVADLY KIDINLFSYQ Y                231
//

If you have problems or comments...

PBIL Back to PBIL home page