(data stored in ACNUC5340 zone)

EMBL: CP000828.PE468

CP000828.PE468       Location/Qualifiers
FT   CDS             481826..482071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0508"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25559"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC17"
FT                   /protein_id="ABW25559.1"
FT                   /translation="MIFDHLRQFRQTLYSCFGASKDALFELMDAVLMSPSLRSFVCLSQ
FT                   HPIFRRQWSSTYSALHDGRIHRAKLHRYLGFAEKVN"
     MIFDHLRQFR QTLYSCFGAS KDALFELMDA VLMSPSLRSF VCLSQHPIFR RQWSSTYSAL        60
     HDGRIHRAKL HRYLGFAEKV N                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page