(data stored in ACNUC5340 zone)

EMBL: CP000828.PE469

CP000828.PE469       Location/Qualifiers
FT   CDS             complement(482045..483628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0507"
FT                   /product="transposase, IS5 family, putative"
FT                   /note="Has a domain with similarity to IS4 family
FT                   transposases."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25560"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B0C0G8"
FT                   /protein_id="ABW25560.1"
FT                   /translation="MYRRPSPGQLSFENFYLPFGGKLSGENRWVKLAELIPWESFESEY
FT                   ADQFSQTMGAPAKPFRVALGTLIIKEKLGISDAETVEQIRENPYLQYFLGFSEYRESAP
FT                   FDASMLVHFRQRLNLELLAQVNDAVVDSVLASEGSPVAMSPESSPPSDDDEDEPPAPPN
FT                   QGQLLIDATCAPADIRYPTDLDLLNDARKASEAILDALYAQVMLSLKCKPRTYRQKARK
FT                   AYLAIAKKRQPSRKLIRKGIRQQLGYVRRNLAHIDGLITLGASLSQLSRRQYRLLLVIH
FT                   EVFRQQEWMYQQSVRRVDDRIVSMSQPHVRPMVRGKAGTPVEFGAKLSLSCVRGCVFLE
FT                   RLSWDAFNESQHLQHQVEAFRRRFGHYPFSVHADQIYRTRANRRWCKARGIRLSGPPLG
FT                   RPQQDPQVQTQLKQQACEDEKVRVQIEGKFGQAKRRFGLNRVMAKLADTAASAIAITFL
FT                   VMNLERWLSHFLSFIFGVGLLVLESVMELSGLPWGFARASQRIWLWPSQMGCLYDLMHG
FT                   ICSIYFLSKP"
     MYRRPSPGQL SFENFYLPFG GKLSGENRWV KLAELIPWES FESEYADQFS QTMGAPAKPF        60
     RVALGTLIIK EKLGISDAET VEQIRENPYL QYFLGFSEYR ESAPFDASML VHFRQRLNLE       120
     LLAQVNDAVV DSVLASEGSP VAMSPESSPP SDDDEDEPPA PPNQGQLLID ATCAPADIRY       180
     PTDLDLLNDA RKASEAILDA LYAQVMLSLK CKPRTYRQKA RKAYLAIAKK RQPSRKLIRK       240
     GIRQQLGYVR RNLAHIDGLI TLGASLSQLS RRQYRLLLVI HEVFRQQEWM YQQSVRRVDD       300
     RIVSMSQPHV RPMVRGKAGT PVEFGAKLSL SCVRGCVFLE RLSWDAFNES QHLQHQVEAF       360
     RRRFGHYPFS VHADQIYRTR ANRRWCKARG IRLSGPPLGR PQQDPQVQTQ LKQQACEDEK       420
     VRVQIEGKFG QAKRRFGLNR VMAKLADTAA SAIAITFLVM NLERWLSHFL SFIFGVGLLV       480
     LESVMELSGL PWGFARASQR IWLWPSQMGC LYDLMHGICS IYFLSKP                     527
//

If you have problems or comments...

PBIL Back to PBIL home page