(data stored in ACNUC5340 zone)

EMBL: CP000828.PE470

CP000828.PE470       Location/Qualifiers
FT   CDS             483787..484830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0509"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25561"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC19"
FT                   /protein_id="ABW25561.1"
FT                   /translation="MGDSSPWLRPEAKTLKDRGFHHQGGHTVGVGQSYSTLSWVPDESQ
FT                   HWALPLRHERITSFETALTKATFQLKQVCRHLPVRPLAAFDRHYGNGIFLNHTAGIEVD
FT                   LLLRLASNRCVYGIPLAYSGRGAPRKHGHKFKLNAPNTYPEASEILEIEDTQLGQVRVT
FT                   RWSQFHFRNSAKREMEILRVEIIQPKGKRRKFKPLWLAWTGECMPSLERLWRRYLQRFS
FT                   IEHWYRFAKQRLYWTTPQLTSNEATERWSTLIGMISWQLWFARSDCMDTPLPWQSPQQV
FT                   LSPGRVAQAFPSIIAAIGTPAQAPKTRGKSPGRKQGQSQPPRTRYPTVKKRVSKRRKAK
FT                   IVSKTAA"
     MGDSSPWLRP EAKTLKDRGF HHQGGHTVGV GQSYSTLSWV PDESQHWALP LRHERITSFE        60
     TALTKATFQL KQVCRHLPVR PLAAFDRHYG NGIFLNHTAG IEVDLLLRLA SNRCVYGIPL       120
     AYSGRGAPRK HGHKFKLNAP NTYPEASEIL EIEDTQLGQV RVTRWSQFHF RNSAKREMEI       180
     LRVEIIQPKG KRRKFKPLWL AWTGECMPSL ERLWRRYLQR FSIEHWYRFA KQRLYWTTPQ       240
     LTSNEATERW STLIGMISWQ LWFARSDCMD TPLPWQSPQQ VLSPGRVAQA FPSIIAAIGT       300
     PAQAPKTRGK SPGRKQGQSQ PPRTRYPTVK KRVSKRRKAK IVSKTAA                     347
//

If you have problems or comments...

PBIL Back to PBIL home page