(data stored in ACNUC5340 zone)

EMBL: CP000828.PE471

CP000828.PE471       Location/Qualifiers
FT   CDS             complement(485023..485331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0510"
FT                   /product="peptidase S26 family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25562"
FT                   /db_xref="GOA:B0CC20"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR014124"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC20"
FT                   /protein_id="ABW25562.1"
FT                   /translation="MLWCCRRRRRWEVQGRSMMPTLSPGDQVLIDPRAYRLTTPQVGDI
FT                   VLARHPFQSQLYLIKRIQSVDDNSYFLIGDNAPESTDSRVFHAVPLDCIVGKVTSFF"
     MLWCCRRRRR WEVQGRSMMP TLSPGDQVLI DPRAYRLTTP QVGDIVLARH PFQSQLYLIK        60
     RIQSVDDNSY FLIGDNAPES TDSRVFHAVP LDCIVGKVTS FF                          102
//

If you have problems or comments...

PBIL Back to PBIL home page