(data stored in ACNUC5340 zone)

EMBL: CP000828.PE473

CP000828.PE473       Location/Qualifiers
FT   CDS             complement(485925..486413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0512"
FT                   /product="TPR domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25564"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC22"
FT                   /protein_id="ABW25564.1"
FT                   /translation="MAYDPQIYSSYELNWQLHTQAGNQCLLAGSYLEALHAYRKAIALA
FT                   ELMLMTAKKERRHPEAIHAYVMACHNLADNLVKLEDFQVAETTMQQALDRVVDLMHATH
FT                   YFQCLRIEAAKALKMVSLKVYEFYLRLGQQDKARRVFEHNTELAQMFFSQIQPRLLSV"
     MAYDPQIYSS YELNWQLHTQ AGNQCLLAGS YLEALHAYRK AIALAELMLM TAKKERRHPE        60
     AIHAYVMACH NLADNLVKLE DFQVAETTMQ QALDRVVDLM HATHYFQCLR IEAAKALKMV       120
     SLKVYEFYLR LGQQDKARRV FEHNTELAQM FFSQIQPRLL SV                          162
//

If you have problems or comments...

PBIL Back to PBIL home page