(data stored in ACNUC27125 zone)

EMBL: CP000828.PE474

CP000828.PE474       Location/Qualifiers
FT   CDS             487003..487485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0513"
FT                   /product="Mov34/MPN/PAD-1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25565"
FT                   /db_xref="InterPro:IPR000555"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC23"
FT                   /protein_id="ABW25565.1"
FT                   /translation="MDQIYDHAQDCYPEECCGLMLGKILEPDAQLEKKLFELYPLDNAW
FT                   EQAESSIRIEESGTPLTATRRYWIAPQDLFNAQKYARTQGWDIIGVYHSHPDHEAVPSE
FT                   CDRKWAWPQYSYVIVAVKNGVPHDFRNWILDDQQQFRAEPVTVVDDVVPSTLETDI"
     MDQIYDHAQD CYPEECCGLM LGKILEPDAQ LEKKLFELYP LDNAWEQAES SIRIEESGTP        60
     LTATRRYWIA PQDLFNAQKY ARTQGWDIIG VYHSHPDHEA VPSECDRKWA WPQYSYVIVA       120
     VKNGVPHDFR NWILDDQQQF RAEPVTVVDD VVPSTLETDI                             160
//

If you have problems or comments...

PBIL Back to PBIL home page