(data stored in ACNUC5340 zone)

EMBL: CP000828.PE477

CP000828.PE477       Location/Qualifiers
FT   CDS             complement(489385..490653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0516"
FT                   /product="two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25568"
FT                   /db_xref="GOA:B0CC26"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC26"
FT                   /protein_id="ABW25568.1"
FT                   /translation="MSRLFRSNHPFHLLLYLEWILLGVALLTLFVPFPRHHFLLPHFTP
FT                   RGALRFPLGIFLSILALAGLGLKLPIHQSQKVKVLYTCLGFLLCWATVFMGGRFRDFFT
FT                   PMLLIVVIRACLLFPCRQRLIAASVAYGSFLVRLMTGAQRMRPFPRLGPPPPWRSRGLP
FT                   QELLASLQIRSALLFGLVLVFVFLMVGALLTERQSRTELAAANQRLRQYALMIENQATL
FT                   QERNRIAREMHDSVGHSLTAQSIQLENVDVWMASDRAKATDHLAKARSLGKEALQNVRH
FT                   TVATLRNNPLQGQSLSQALSHLTQEFERTTSIQVQFSTHLEMPVPREMAAALYRLVQEA
FT                   LTNVSKHSEATQVTIELTEQEMELSLNISDNGKGFLPEKNTTGFGLQGMQERTVALGGL
FT                   FELWSQPQTGCHIQIKIPRLGEE"
     MSRLFRSNHP FHLLLYLEWI LLGVALLTLF VPFPRHHFLL PHFTPRGALR FPLGIFLSIL        60
     ALAGLGLKLP IHQSQKVKVL YTCLGFLLCW ATVFMGGRFR DFFTPMLLIV VIRACLLFPC       120
     RQRLIAASVA YGSFLVRLMT GAQRMRPFPR LGPPPPWRSR GLPQELLASL QIRSALLFGL       180
     VLVFVFLMVG ALLTERQSRT ELAAANQRLR QYALMIENQA TLQERNRIAR EMHDSVGHSL       240
     TAQSIQLENV DVWMASDRAK ATDHLAKARS LGKEALQNVR HTVATLRNNP LQGQSLSQAL       300
     SHLTQEFERT TSIQVQFSTH LEMPVPREMA AALYRLVQEA LTNVSKHSEA TQVTIELTEQ       360
     EMELSLNISD NGKGFLPEKN TTGFGLQGMQ ERTVALGGLF ELWSQPQTGC HIQIKIPRLG       420
     EE                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page