(data stored in ACNUC27125 zone)

EMBL: CP000828.PE48

CP000828.PE48        Location/Qualifiers
FT   CDS             complement(51179..51940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25139"
FT                   /db_xref="UniProtKB/TrEMBL:B0C527"
FT                   /protein_id="ABW25139.1"
FT                   /translation="MSSFKLILKSLLFSSLLLAVPKVSQAAPTGTWLSQPQIRYHVSSN
FT                   TLTEAMAKIKKQNYKVVFLDYRNVSDDVQQKVSQAARENQLKPVVWIQSPQLRSLSVSQ
FT                   LINEAKHTDGLQVDDHYFKHYSSKDFAELRSAYDKPIYCSIQPFQARQVPAQGCYQVDV
FT                   QCYTPTTLRRCMGLADRLNAVTSLATKRTLKYRQKLGNRKFNVFLWPHTNDFFKRTSQV
FT                   EAQENINSVLEVTSLVLSEAAISTVMPTELR"
     MSSFKLILKS LLFSSLLLAV PKVSQAAPTG TWLSQPQIRY HVSSNTLTEA MAKIKKQNYK        60
     VVFLDYRNVS DDVQQKVSQA ARENQLKPVV WIQSPQLRSL SVSQLINEAK HTDGLQVDDH       120
     YFKHYSSKDF AELRSAYDKP IYCSIQPFQA RQVPAQGCYQ VDVQCYTPTT LRRCMGLADR       180
     LNAVTSLATK RTLKYRQKLG NRKFNVFLWP HTNDFFKRTS QVEAQENINS VLEVTSLVLS       240
     EAAISTVMPT ELR                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page