(data stored in ACNUC27125 zone)

EMBL: CP000828.PE481

CP000828.PE481       Location/Qualifiers
FT   CDS             492902..493978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25572"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC30"
FT                   /protein_id="ABW25572.1"
FT                   /translation="MDWRDPLWSDLLTHLSHDIYHLPEYLYCEALRTQSIPEAILITEG
FT                   QKVCLIPYLRRSCNFIPTASSPTNIYDITSPNGYSGFLLNPAALDDSAFGFHAWQQFLD
FT                   LGKEQGICSAFLRLHPSLNTIHPQGINNILVKKVGHTVSINLGLSESDLWSHTHKSQRN
FT                   KINRGKRLGLVAKIKPFSEYINEFCNIYEATMQRVEAETSFFSFNRDYFYLLQKHLGHK
FT                   LFVCIVEYQDEIISAGLYSECSGIVQGLLGGTTPEGLKLSPTSLEFYQTSLWAKQRGNT
FT                   ILHLGGGVGCSEDGLYQYKANFSKQRHEFYTASIIIKPLQYKLLLESHSKAHNIDLDHL
FT                   NSIQFFPAYRYRPNPSEF"
     MDWRDPLWSD LLTHLSHDIY HLPEYLYCEA LRTQSIPEAI LITEGQKVCL IPYLRRSCNF        60
     IPTASSPTNI YDITSPNGYS GFLLNPAALD DSAFGFHAWQ QFLDLGKEQG ICSAFLRLHP       120
     SLNTIHPQGI NNILVKKVGH TVSINLGLSE SDLWSHTHKS QRNKINRGKR LGLVAKIKPF       180
     SEYINEFCNI YEATMQRVEA ETSFFSFNRD YFYLLQKHLG HKLFVCIVEY QDEIISAGLY       240
     SECSGIVQGL LGGTTPEGLK LSPTSLEFYQ TSLWAKQRGN TILHLGGGVG CSEDGLYQYK       300
     ANFSKQRHEF YTASIIIKPL QYKLLLESHS KAHNIDLDHL NSIQFFPAYR YRPNPSEF         358
//

If you have problems or comments...

PBIL Back to PBIL home page