(data stored in ACNUC8465 zone)

EMBL: CP000828.PE488

CP000828.PE488       Location/Qualifiers
FT   CDS             503988..504116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0527"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25579"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC37"
FT                   /protein_id="ABW25579.1"
FT                   /translation="MLGFRNHVFNLRQRLPGVRWEFAILPAYILVNDIYLLAAVPS"
     MLGFRNHVFN LRQRLPGVRW EFAILPAYIL VNDIYLLAAV PS                           42
//

If you have problems or comments...

PBIL Back to PBIL home page