(data stored in ACNUC27125 zone)

EMBL: CP000828.PE489

CP000828.PE489       Location/Qualifiers
FT   CDS             complement(504339..504821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25580"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC38"
FT                   /protein_id="ABW25580.1"
FT                   /translation="MLKEGQLLSLSESYPAGLILQKPYYAEYIGPGSAVGGMFDLQCVT
FT                   IHPLGKAELSTPETLDERQNAFQRRMEDIEQMQLICEKDLPIERAVAVLEMLTQHFYQD
FT                   EIQMIPNEVLAKLVGVLPSTMATAWKQLSTGGRKPSAPSQSSAPEPSFASHEVAFA"
     MLKEGQLLSL SESYPAGLIL QKPYYAEYIG PGSAVGGMFD LQCVTIHPLG KAELSTPETL        60
     DERQNAFQRR MEDIEQMQLI CEKDLPIERA VAVLEMLTQH FYQDEIQMIP NEVLAKLVGV       120
     LPSTMATAWK QLSTGGRKPS APSQSSAPEP SFASHEVAFA                             160
//

If you have problems or comments...

PBIL Back to PBIL home page