(data stored in ACNUC27125 zone)

EMBL: CP000828.PE49

CP000828.PE49        Location/Qualifiers
FT   CDS             complement(52360..52623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0052"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25140"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:B0C528"
FT                   /protein_id="ABW25140.1"
FT                   /translation="MSILAAVPALAAPAYLVGAQPGSRVNVRSAPSTSSYSPHYGLVGD
FT                   RVQVINSTTGNDGYYWYYVEFPSGARGWIRGDFVQVQQPRRF"
     MSILAAVPAL AAPAYLVGAQ PGSRVNVRSA PSTSSYSPHY GLVGDRVQVI NSTTGNDGYY        60
     WYYVEFPSGA RGWIRGDFVQ VQQPRRF                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page