(data stored in ACNUC27125 zone)

EMBL: CP000828.PE493

CP000828.PE493       Location/Qualifiers
FT   CDS             511830..513290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0532"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25584"
FT                   /db_xref="GOA:B0CC42"
FT                   /db_xref="InterPro:IPR021435"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC42"
FT                   /protein_id="ABW25584.1"
FT                   /translation="MLGYFLVVVIIILGGAIATLGDRIGSKVGKARLSLFNLRPKNTAI
FT                   VITIMTGAVISALTLGIVFAFSQQFRDALFRFDDIQKRSRIVQKELAETQAEKDSIEVN
FT                   LTRSRTSLSRTRQRLRTANRSLVKAITREKRIERQLKQTQRRFLQSKQQITQFAGQARQ
FT                   LRSQIQSLRTEQKNLRVQRNQSEARLKQVNAQKRKLETAITQAQTRLRQVEVQKQELTT
FT                   TITKGRQELRAANQQRQQLQQDVQALEANRERLEKNVEFLLLGLRRGTIAIRTGQVLTS
FT                   AVIQDINSKADAIQAINTLLTQARQSAIALSNLTDLPNEQQVVQMRQSDVERLAIRIGD
FT                   GKSYVVKILAAASYLQGERTIFVVPQLAANRVIYQADTRIARISVQPAQVSDEQLLLQI
FT                   EQLLRVVNRQAIVAGFLPDPLTGTVGTFRQVDLFRFILALKDRNDSGPVDIIAITPNTV
FT                   LTAGPLAIELIAIKDQQIILRSNAPEPS"
     MLGYFLVVVI IILGGAIATL GDRIGSKVGK ARLSLFNLRP KNTAIVITIM TGAVISALTL        60
     GIVFAFSQQF RDALFRFDDI QKRSRIVQKE LAETQAEKDS IEVNLTRSRT SLSRTRQRLR       120
     TANRSLVKAI TREKRIERQL KQTQRRFLQS KQQITQFAGQ ARQLRSQIQS LRTEQKNLRV       180
     QRNQSEARLK QVNAQKRKLE TAITQAQTRL RQVEVQKQEL TTTITKGRQE LRAANQQRQQ       240
     LQQDVQALEA NRERLEKNVE FLLLGLRRGT IAIRTGQVLT SAVIQDINSK ADAIQAINTL       300
     LTQARQSAIA LSNLTDLPNE QQVVQMRQSD VERLAIRIGD GKSYVVKILA AASYLQGERT       360
     IFVVPQLAAN RVIYQADTRI ARISVQPAQV SDEQLLLQIE QLLRVVNRQA IVAGFLPDPL       420
     TGTVGTFRQV DLFRFILALK DRNDSGPVDI IAITPNTVLT AGPLAIELIA IKDQQIILRS       480
     NAPEPS                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page