(data stored in ACNUC27125 zone)

EMBL: CP000828.PE503

CP000828.PE503       Location/Qualifiers
FT   CDS             complement(524745..526202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0544"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25594"
FT                   /db_xref="GOA:B0CC52"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC52"
FT                   /protein_id="ABW25594.1"
FT                   /translation="MSASLSRLGQPSYLALNRLGNEPNKGFALPLALGLGFVMVILGLS
FT                   TIMIAQSDRTSAFSRKEAGASLAVSEGGMARMLSQMTQPNNRILLTRSYDTINPKTGTT
FT                   YLGPDGILNSGDEETTAIDEWTGYTGSTSSPCEDTGTTITPSVTTSGNMGSGGQYQLKA
FT                   YRYNPTEQTGTLLIEGKQGERVSYVLSTLSIQSEVENFPGVLAMEGAYIRGRTLIGQHA
FT                   NLYFDPAYSVDSSLTDKSAPNDVDRSAYLNAIYSTATDGPAEDLIAGNIVGCKVTQTLS
FT                   VDLPSTVRSLGSVRSSTTLTAADSPYHIEELELDGTNVVNVDTTDGPVYLYVTKSFELR
FT                   GNAQLRNIRTDGQLPRVGDLRIIVHNAVGPNLAIELYDQSCIDTAFVYNTENDLHLQGT
FT                   GDGCPSSGNTNFDGVAWVEDVVSSINITPHTRSVPSEDFDIITTNGSTSGIRVPNDVSS
FT                   LADVVSGIGITPKNKFGYVKSWQRVRL"
     MSASLSRLGQ PSYLALNRLG NEPNKGFALP LALGLGFVMV ILGLSTIMIA QSDRTSAFSR        60
     KEAGASLAVS EGGMARMLSQ MTQPNNRILL TRSYDTINPK TGTTYLGPDG ILNSGDEETT       120
     AIDEWTGYTG STSSPCEDTG TTITPSVTTS GNMGSGGQYQ LKAYRYNPTE QTGTLLIEGK       180
     QGERVSYVLS TLSIQSEVEN FPGVLAMEGA YIRGRTLIGQ HANLYFDPAY SVDSSLTDKS       240
     APNDVDRSAY LNAIYSTATD GPAEDLIAGN IVGCKVTQTL SVDLPSTVRS LGSVRSSTTL       300
     TAADSPYHIE ELELDGTNVV NVDTTDGPVY LYVTKSFELR GNAQLRNIRT DGQLPRVGDL       360
     RIIVHNAVGP NLAIELYDQS CIDTAFVYNT ENDLHLQGTG DGCPSSGNTN FDGVAWVEDV       420
     VSSINITPHT RSVPSEDFDI ITTNGSTSGI RVPNDVSSLA DVVSGIGITP KNKFGYVKSW       480
     QRVRL                                                                   485
//

If you have problems or comments...

PBIL Back to PBIL home page