(data stored in ACNUC27125 zone)

EMBL: CP000828.PE505

CP000828.PE505       Location/Qualifiers
FT   CDS             528831..529232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25596"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC54"
FT                   /protein_id="ABW25596.1"
FT                   /translation="MSRSKSILSLGSCAFVALSAILPFGAHAQADPSQLGIPEETTFAI
FT                   ITRMSDTVAARISASSCKDTRDLLKEMRKSKGSKTSELSLEGQLLASARTQPKLQQVVA
FT                   NRVGTALALKLMECNMMNPDTLGALFDKK"
     MSRSKSILSL GSCAFVALSA ILPFGAHAQA DPSQLGIPEE TTFAIITRMS DTVAARISAS        60
     SCKDTRDLLK EMRKSKGSKT SELSLEGQLL ASARTQPKLQ QVVANRVGTA LALKLMECNM       120
     MNPDTLGALF DKK                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page