(data stored in ACNUC5340 zone)

EMBL: CP000828.PE507

CP000828.PE507       Location/Qualifiers
FT   CDS             complement(530576..532939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0548"
FT                   /product="diguanylate cyclase/phosphodiesterase with GAF
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25598"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR012226"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC56"
FT                   /protein_id="ABW25598.1"
FT                   /translation="MNDFATNPLDRQSELTELGQKALSGFSLTDLYLDAIALMSHHLPI
FT                   SDCSLWQVLSDSNTLRLVAKQKASLLGDSTDIDSRDYPWLQTLMQTGQTAVIARQSEQL
FT                   PLTQPHGISGLCIPIPGPDRPLGLLEILTPDPQNWNKEDRNFVNCVAQVLATAIQRKRS
FT                   EMLLQTQTQILENVATGQGLDAILNSLCLLIESQSPGTVCSILLRDAHQPELRMGAGPS
FT                   LSSEVAAAFDHLIIAENAGSCGTAAFRGQAVYVEDTQRDPVWVDFREFAQQHNILACWS
FT                   TPFFSQSGDLLGTFALSHQVPCSPTAHHLNIIKTATHLASIAMEGHRTAEQLKQKALFD
FT                   NLTGLPSRDYFYEQLQRKLQQVQRQQLEGYSRQAELCHFAILFLDVDHFKLVNDSLGHS
FT                   VGDQLLVAIAQQLKESLRPQDLLARLGGDEFAILLDGVVNHQQAHKIVQRIQRSLAKPL
FT                   KLNQQEVFTSVSIGITHSTSLYQHPEELLRDADTAMYRAKAHGRGGYVVFDETMHKQVR
FT                   SRLWLGNSLRYAVKAIEQGQNPFLLQYQPIFCLRQQRLIGFEALLRWHHPQQGLISPEK
FT                   FIPVAEETGLIIPLGQWVLKAACQQLAVWEQEFSVPLTMSINVSSQQFLQPNFVQSVES
FT                   LMQSHQLAGHHLKLEITETVLMESTHYVTDRLEQLQNLGISLSLDDFGTGYSSLNYLYN
FT                   LPINTLKIDRSFVWGIGQGQDQIVKTIIALAHGLEMNVVAEGIETIEQMQYLHTLGCEL
FT                   GQGYWFARPLQPEAAQQVIATLSSPMSLSLPIAE"
     MNDFATNPLD RQSELTELGQ KALSGFSLTD LYLDAIALMS HHLPISDCSL WQVLSDSNTL        60
     RLVAKQKASL LGDSTDIDSR DYPWLQTLMQ TGQTAVIARQ SEQLPLTQPH GISGLCIPIP       120
     GPDRPLGLLE ILTPDPQNWN KEDRNFVNCV AQVLATAIQR KRSEMLLQTQ TQILENVATG       180
     QGLDAILNSL CLLIESQSPG TVCSILLRDA HQPELRMGAG PSLSSEVAAA FDHLIIAENA       240
     GSCGTAAFRG QAVYVEDTQR DPVWVDFREF AQQHNILACW STPFFSQSGD LLGTFALSHQ       300
     VPCSPTAHHL NIIKTATHLA SIAMEGHRTA EQLKQKALFD NLTGLPSRDY FYEQLQRKLQ       360
     QVQRQQLEGY SRQAELCHFA ILFLDVDHFK LVNDSLGHSV GDQLLVAIAQ QLKESLRPQD       420
     LLARLGGDEF AILLDGVVNH QQAHKIVQRI QRSLAKPLKL NQQEVFTSVS IGITHSTSLY       480
     QHPEELLRDA DTAMYRAKAH GRGGYVVFDE TMHKQVRSRL WLGNSLRYAV KAIEQGQNPF       540
     LLQYQPIFCL RQQRLIGFEA LLRWHHPQQG LISPEKFIPV AEETGLIIPL GQWVLKAACQ       600
     QLAVWEQEFS VPLTMSINVS SQQFLQPNFV QSVESLMQSH QLAGHHLKLE ITETVLMEST       660
     HYVTDRLEQL QNLGISLSLD DFGTGYSSLN YLYNLPINTL KIDRSFVWGI GQGQDQIVKT       720
     IIALAHGLEM NVVAEGIETI EQMQYLHTLG CELGQGYWFA RPLQPEAAQQ VIATLSSPMS       780
     LSLPIAE                                                                 787
//

If you have problems or comments...

PBIL Back to PBIL home page