(data stored in ACNUC27125 zone)

EMBL: CP000828.PE525

CP000828.PE525       Location/Qualifiers
FT   CDS             554839..556179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0566"
FT                   /product="TRAP transporter solute receptor, TAXI family,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25616"
FT                   /db_xref="GOA:B0CD25"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD25"
FT                   /protein_id="ABW25616.1"
FT                   /translation="MGLVSTRIYVIDTIGCFERMNRGRITVSILIISLLTAGGMAVQVF
FT                   RQHRQSYVLTLATASKTGEYYQFGQALATVVARHHPQIQINVIQTEGSSQNLELIESGA
FT                   AQLALIQGDSSIQSSAQAMALLFPETAHVLVNRQAGIETMADLPGKQVALPPKGSGAYQ
FT                   LFMPIAQHYGFNTDQIRSFSSASTAYQQLKEGEVDALFQVIRPGNKALRKILRLPNIDL
FT                   IPIEQTDALRLTYPYLEDAFIPQGTYDGKIPLPFQDVKTVAVRALIIANKQVNAEVIYA
FT                   ITRVLHERKMEIVTAYPPAFTIERPESQDILGWSLHAGAEQYYTKNQPNFWVQYAELLG
FT                   LFLSLAVLGISGIWQLRLWLIGRQKNRADMYNLQLLDLIETIQETQDLEELKQVRRRLF
FT                   SILQAVVIDLDKDRISAESFQSFTMPWEVAITTLRHRETILLKVQSP"
     MGLVSTRIYV IDTIGCFERM NRGRITVSIL IISLLTAGGM AVQVFRQHRQ SYVLTLATAS        60
     KTGEYYQFGQ ALATVVARHH PQIQINVIQT EGSSQNLELI ESGAAQLALI QGDSSIQSSA       120
     QAMALLFPET AHVLVNRQAG IETMADLPGK QVALPPKGSG AYQLFMPIAQ HYGFNTDQIR       180
     SFSSASTAYQ QLKEGEVDAL FQVIRPGNKA LRKILRLPNI DLIPIEQTDA LRLTYPYLED       240
     AFIPQGTYDG KIPLPFQDVK TVAVRALIIA NKQVNAEVIY AITRVLHERK MEIVTAYPPA       300
     FTIERPESQD ILGWSLHAGA EQYYTKNQPN FWVQYAELLG LFLSLAVLGI SGIWQLRLWL       360
     IGRQKNRADM YNLQLLDLIE TIQETQDLEE LKQVRRRLFS ILQAVVIDLD KDRISAESFQ       420
     SFTMPWEVAI TTLRHRETIL LKVQSP                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page