(data stored in ACNUC8465 zone)

EMBL: CP000828.PE53

CP000828.PE53        Location/Qualifiers
FT   CDS             complement(55937..56479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25144"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B0C532"
FT                   /protein_id="ABW25144.1"
FT                   /translation="MAIFRNAISGLIGLLLLVVIGGLILPSDVHVERNILINASPAEIF
FT                   PVVSDLSKWSAWSPWAKMDPNMALTIEGDGVGQTMHWQSEDPMVGTGTQEITAMGESSY
FT                   IQTHLDFGQQGTADAALQLAPQDNGTLVAWSLDTDVSAGVPPVMKPVSSYLRFVLESAV
FT                   GQDYEAGLSNLKALIER"
     MAIFRNAISG LIGLLLLVVI GGLILPSDVH VERNILINAS PAEIFPVVSD LSKWSAWSPW        60
     AKMDPNMALT IEGDGVGQTM HWQSEDPMVG TGTQEITAMG ESSYIQTHLD FGQQGTADAA       120
     LQLAPQDNGT LVAWSLDTDV SAGVPPVMKP VSSYLRFVLE SAVGQDYEAG LSNLKALIER       180
//

If you have problems or comments...

PBIL Back to PBIL home page