(data stored in ACNUC27125 zone)

EMBL: CP000828.PE550

CP000828.PE550       Location/Qualifiers
FT   CDS             578342..578461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25641"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD50"
FT                   /protein_id="ABW25641.1"
FT                   /translation="MWAKVTTEVQNVCINFPYGMLPSTVPCFMKDNRATISLS"
     MWAKVTTEVQ NVCINFPYGM LPSTVPCFMK DNRATISLS                               39
//

If you have problems or comments...

PBIL Back to PBIL home page