(data stored in ACNUC8465 zone)

EMBL: CP000828.PE552

CP000828.PE552       Location/Qualifiers
FT   CDS             complement(579654..581450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0593"
FT                   /product="TrkA-C domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25643"
FT                   /db_xref="GOA:B0CD52"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD52"
FT                   /protein_id="ABW25643.1"
FT                   /translation="MEPIFQTLLVTGLTLLCFVFEWLPPDLTAICVMVVLMLLGLVTTA
FT                   EGLSGFSNPATITVMAMFILSSGIARTGAIQMASEFLLKWGGKRPARHMLIMGAVIGPF
FT                   TAIINNVAIVSVFLPVVEDWSRQRRIPVSKLMIPLSYITILGGMITVLGTSTSVLASGL
FT                   SSDLGLGSFDIFQFTALSLCTFTAGLVYMATIGHRLLPNRKTSSSLSQGYGLKDYVSEV
FT                   VITPQSGLVGQTVQSSLIQRIYDVDILELIHDDNHFPQPLADKTLSAGDILLVRGGRED
FT                   LLKIRDGQGLEILPDVQFGQKSWQADLSAEEGAAEAMVLADSNLIGSTLKDLRFRQRYN
FT                   CTVLAIRRGQELVRDRLGKVRLRFGDLLLVQGPKQSLVGLQTSKDLLVMEQRDVENLRR
FT                   DKAWIAIAIGLLVVGVAGTKRFSIAVTALAGVMLMVLTGCLKPGELYRAVRWDVVFLLA
FT                   GLFPLGIAMKKSGATQLLADQLISVGGQLSGYWLLTLFFVLTALLTEILSNNATVILLL
FT                   PVAVQVAQELGYNPFAFMFVVTFAASNSFMTPIGYQTNTMVYGTGGYRFLDFLRVGGPL
FT                   SLLMALITPPLIILLYGLQPLS"
     MEPIFQTLLV TGLTLLCFVF EWLPPDLTAI CVMVVLMLLG LVTTAEGLSG FSNPATITVM        60
     AMFILSSGIA RTGAIQMASE FLLKWGGKRP ARHMLIMGAV IGPFTAIINN VAIVSVFLPV       120
     VEDWSRQRRI PVSKLMIPLS YITILGGMIT VLGTSTSVLA SGLSSDLGLG SFDIFQFTAL       180
     SLCTFTAGLV YMATIGHRLL PNRKTSSSLS QGYGLKDYVS EVVITPQSGL VGQTVQSSLI       240
     QRIYDVDILE LIHDDNHFPQ PLADKTLSAG DILLVRGGRE DLLKIRDGQG LEILPDVQFG       300
     QKSWQADLSA EEGAAEAMVL ADSNLIGSTL KDLRFRQRYN CTVLAIRRGQ ELVRDRLGKV       360
     RLRFGDLLLV QGPKQSLVGL QTSKDLLVME QRDVENLRRD KAWIAIAIGL LVVGVAGTKR       420
     FSIAVTALAG VMLMVLTGCL KPGELYRAVR WDVVFLLAGL FPLGIAMKKS GATQLLADQL       480
     ISVGGQLSGY WLLTLFFVLT ALLTEILSNN ATVILLLPVA VQVAQELGYN PFAFMFVVTF       540
     AASNSFMTPI GYQTNTMVYG TGGYRFLDFL RVGGPLSLLM ALITPPLIIL LYGLQPLS         598
//

If you have problems or comments...

PBIL Back to PBIL home page