(data stored in ACNUC27125 zone)

EMBL: CP000828.PE556

CP000828.PE556       Location/Qualifiers
FT   CDS             complement(583921..584661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25647"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD56"
FT                   /protein_id="ABW25647.1"
FT                   /translation="MPIVDKIRMTLNNTDSEFNHPRSKLKDHKALEQSDIVANITMNRN
FT                   RALMGDNSYGKEFDLNPATVLENRLKEKGEAAWLDLCCGRGRALIDAAIAFGTNDLTLH
FT                   GVDLVDHFDPRSTQYPAITLTVSSLHTWTTTQRYDLVTCIYGLHYIGDKLGLITKAVSW
FT                   LNSNGIFLANLDLNHVLNQDGTAFTKKLTNWFQTSGFEFDRQSGVLQKAGSAMLSSPFE
FT                   YLGADDRAGPNATGQPGVASYYRV"
     MPIVDKIRMT LNNTDSEFNH PRSKLKDHKA LEQSDIVANI TMNRNRALMG DNSYGKEFDL        60
     NPATVLENRL KEKGEAAWLD LCCGRGRALI DAAIAFGTND LTLHGVDLVD HFDPRSTQYP       120
     AITLTVSSLH TWTTTQRYDL VTCIYGLHYI GDKLGLITKA VSWLNSNGIF LANLDLNHVL       180
     NQDGTAFTKK LTNWFQTSGF EFDRQSGVLQ KAGSAMLSSP FEYLGADDRA GPNATGQPGV       240
     ASYYRV                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page