(data stored in ACNUC5340 zone)

EMBL: CP000828.PE559

CP000828.PE559       Location/Qualifiers
FT   CDS             complement(588237..589340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0600"
FT                   /product="TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25650"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD59"
FT                   /protein_id="ABW25650.1"
FT                   /translation="MLSMRLLSTSILLILGVGVIIPEQVNSPVHAEPIAQVNKDRQLFQ
FT                   LFKKGKELVEANDLDMALQAYRQATLLDTKNPRIFSAIGYIQAQRKDFARSVEAYKKAI
FT                   ALDGKNANFHYALGYSLGNLGQNDQAAAAYQKVIELEPKNVRAYEGLAVIYSRQQKYDE
FT                   AFQNFQKVIEINPKNGGAYNSIGLIHLKRNQVEPAVTNLEKAATLSPKNGEIQMNLALA
FT                   YAAQGKTEEGLVALDKAVKLDPRNPKVHLRTGQLLQSQGNNERAITAYKQALRHDKNLG
FT                   AAHEGLGDVLMQKGDALGAVVAFRQATKLEKRNPSAFYKLAKALIARNRHREAIPELHK
FT                   ARQLYQLQRQADGVKKVDTLLKQLSVS"
     MLSMRLLSTS ILLILGVGVI IPEQVNSPVH AEPIAQVNKD RQLFQLFKKG KELVEANDLD        60
     MALQAYRQAT LLDTKNPRIF SAIGYIQAQR KDFARSVEAY KKAIALDGKN ANFHYALGYS       120
     LGNLGQNDQA AAAYQKVIEL EPKNVRAYEG LAVIYSRQQK YDEAFQNFQK VIEINPKNGG       180
     AYNSIGLIHL KRNQVEPAVT NLEKAATLSP KNGEIQMNLA LAYAAQGKTE EGLVALDKAV       240
     KLDPRNPKVH LRTGQLLQSQ GNNERAITAY KQALRHDKNL GAAHEGLGDV LMQKGDALGA       300
     VVAFRQATKL EKRNPSAFYK LAKALIARNR HREAIPELHK ARQLYQLQRQ ADGVKKVDTL       360
     LKQLSVS                                                                 367
//

If you have problems or comments...

PBIL Back to PBIL home page