(data stored in ACNUC8465 zone)

EMBL: CP000828.PE564

CP000828.PE564       Location/Qualifiers
FT   CDS             595341..595697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25655"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD64"
FT                   /protein_id="ABW25655.1"
FT                   /translation="MANFPIPDSIQYADIIRDGGSYWMAYTTANDGICELELQVRKNHN
FT                   YDRIGYWPPTLWIGKSQKKLQLNWGDAEYLAARFSMLLHPDIGWGGTKRAKEMIAYLEA
FT                   KGTLDTTQCKCDDG"
     MANFPIPDSI QYADIIRDGG SYWMAYTTAN DGICELELQV RKNHNYDRIG YWPPTLWIGK        60
     SQKKLQLNWG DAEYLAARFS MLLHPDIGWG GTKRAKEMIA YLEAKGTLDT TQCKCDDG         118
//

If you have problems or comments...

PBIL Back to PBIL home page