(data stored in ACNUC27125 zone)

EMBL: CP000828.PE569

CP000828.PE569       Location/Qualifiers
FT   CDS             601388..601822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25660"
FT                   /db_xref="GOA:B0CD69"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD69"
FT                   /protein_id="ABW25660.1"
FT                   /translation="MATNHKNRLVWAVWTIVTIGMGSAVGALVGSTKASAGTTMAVVTG
FT                   MGCVIGIGALVKAIASRANQDATAGWEALSVKASFLLGAINLSVGLVLAPIAICSIVWP
FT                   FAVINWTQVGMIIGIIASGMGGLLAAMVEIRALENPVVVD"
     MATNHKNRLV WAVWTIVTIG MGSAVGALVG STKASAGTTM AVVTGMGCVI GIGALVKAIA        60
     SRANQDATAG WEALSVKASF LLGAINLSVG LVLAPIAICS IVWPFAVINW TQVGMIIGII       120
     ASGMGGLLAA MVEIRALENP VVVD                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page