(data stored in ACNUC27125 zone)

EMBL: CP000828.PE579

CP000828.PE579       Location/Qualifiers
FT   CDS             complement(608822..609526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25670"
FT                   /db_xref="GOA:B0CD79"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD79"
FT                   /protein_id="ABW25670.1"
FT                   /translation="MEAILMVLAGLLLGIFATVAILYAFLVVLVLPNRESISTFQQHSF
FT                   QQHSSQPQRLTTEVRELSDLQALMEIRQPQPVEAQSWHQDSEYLALKADIQAESQAYQR
FT                   IPTFLRGFMPKPWKKAWQYSESLTYVNDSIPKILGNWDSREFSRQCTPTLLKSTQKDSL
FT                   DQSFADLLGRCGQMTAYQGIKYFGLDNLRGDSVWQFVAQADFENGWAIITGRVIWQGQR
FT                   CWFDHFSISNAI"
     MEAILMVLAG LLLGIFATVA ILYAFLVVLV LPNRESISTF QQHSFQQHSS QPQRLTTEVR        60
     ELSDLQALME IRQPQPVEAQ SWHQDSEYLA LKADIQAESQ AYQRIPTFLR GFMPKPWKKA       120
     WQYSESLTYV NDSIPKILGN WDSREFSRQC TPTLLKSTQK DSLDQSFADL LGRCGQMTAY       180
     QGIKYFGLDN LRGDSVWQFV AQADFENGWA IITGRVIWQG QRCWFDHFSI SNAI             234
//

If you have problems or comments...

PBIL Back to PBIL home page