(data stored in ACNUC5340 zone)

EMBL: CP000828.PE581

CP000828.PE581       Location/Qualifiers
FT   CDS             611563..611748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25672"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD81"
FT                   /protein_id="ABW25672.1"
FT                   /translation="MKDDVVEAAHERQRLSVLHKQLIISLKFHHSQTLEQIPVEMAVQA
FT                   MIEVWQACNPSQSPKD"
     MKDDVVEAAH ERQRLSVLHK QLIISLKFHH SQTLEQIPVE MAVQAMIEVW QACNPSQSPK        60
     D                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page