(data stored in ACNUC8465 zone)

EMBL: CP000828.PE584

CP000828.PE584       Location/Qualifiers
FT   CDS             614282..615121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0626"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25675"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD84"
FT                   /protein_id="ABW25675.1"
FT                   /translation="MFKVYSAPMHTWNWRTCEGRSYLTCSLLDPWPHGFFTREFWPRPP
FT                   AELAPVLKADAQIFRVKQVHGNAVLDPTEVQTYWNQLASQAPETDESVSEFPPADGLIS
FT                   QSKNQAIWVCTADCTPVLIADTRLGHVAAVHAGWRGTAAKIVPVALTRLQAQGSQLKDI
FT                   RVAMGPAIAGEMYQVDTEVAAQVGSTVVAPQLSEQAPEVIAEHLLQVENSPLIADSELG
FT                   RVRLNVRRVNAMQLEQMGVLPDQVAIAPHCTYQDPDKFFSYRREHRKQVQWSGIVSC"
     MFKVYSAPMH TWNWRTCEGR SYLTCSLLDP WPHGFFTREF WPRPPAELAP VLKADAQIFR        60
     VKQVHGNAVL DPTEVQTYWN QLASQAPETD ESVSEFPPAD GLISQSKNQA IWVCTADCTP       120
     VLIADTRLGH VAAVHAGWRG TAAKIVPVAL TRLQAQGSQL KDIRVAMGPA IAGEMYQVDT       180
     EVAAQVGSTV VAPQLSEQAP EVIAEHLLQV ENSPLIADSE LGRVRLNVRR VNAMQLEQMG       240
     VLPDQVAIAP HCTYQDPDKF FSYRREHRKQ VQWSGIVSC                              279
//

If you have problems or comments...

PBIL Back to PBIL home page