(data stored in ACNUC8465 zone)

EMBL: CP000828.PE586

CP000828.PE586       Location/Qualifiers
FT   CDS             615626..616498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0628"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25677"
FT                   /db_xref="GOA:B0CD86"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD86"
FT                   /protein_id="ABW25677.1"
FT                   /translation="MKMRRSFWTDRPRHVSKQEYNRYSFMVFGTVVTGGLGAMLLISSV
FT                   LGMTTWQGNELAELPEMSISEALNHKGKGASPFKISGYLLASDPISMPDEPELKVLKGE
FT                   LQISAKFRDSGETTHEMLFEWQEQVDGVMLSQANRLQTSTQAISVDVDLAQLPLRTDRR
FT                   ARARLQYDGSSRTSRPIAIEYQDQTFPLADLPTTRTVTPKVLRQYFPSGEKVTLIASIE
FT                   SGQTSKLVAPLGQELKILRGSESDIRKTGATARLMFGLTSFVLLGVSYGLGTKAARLRH
FT                   SFVVRSNQP"
     MKMRRSFWTD RPRHVSKQEY NRYSFMVFGT VVTGGLGAML LISSVLGMTT WQGNELAELP        60
     EMSISEALNH KGKGASPFKI SGYLLASDPI SMPDEPELKV LKGELQISAK FRDSGETTHE       120
     MLFEWQEQVD GVMLSQANRL QTSTQAISVD VDLAQLPLRT DRRARARLQY DGSSRTSRPI       180
     AIEYQDQTFP LADLPTTRTV TPKVLRQYFP SGEKVTLIAS IESGQTSKLV APLGQELKIL       240
     RGSESDIRKT GATARLMFGL TSFVLLGVSY GLGTKAARLR HSFVVRSNQP                  290
//

If you have problems or comments...

PBIL Back to PBIL home page