(data stored in ACNUC27125 zone)

EMBL: CP000828.PE59

CP000828.PE59        Location/Qualifiers
FT   CDS             59402..60259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0062"
FT                   /product="integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25150"
FT                   /db_xref="GOA:B0BYN1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B0BYN1"
FT                   /protein_id="ABW25150.1"
FT                   /translation="MVRQLQQDYSIRQICQVLNYPRSQVYYHARGQPDESELKAAIAGV
FT                   AGAYPTYGYRRITAQLQRQGYCVNHKRVARLMRQIGIMAKTKVKRKRTTNSEHSFPRYG
FT                   NRVLNLSIDHPEQVWVADITYIRLQQEFVYLAVVMDVFTRAIRGWHLSRHIDQQLTLRA
FT                   LNKALERATPEIHHSDQGVQYAAAAYMQLLQQHQVQISMAEVGQAWQNGYAERLMRTIK
FT                   EEEVDLSDYRNFTEAYEHIEQFLEDVYMHKRIHSSLGYLTPCEYEQQWRQQNNHYCMNK
FT                   EDSA"
     MVRQLQQDYS IRQICQVLNY PRSQVYYHAR GQPDESELKA AIAGVAGAYP TYGYRRITAQ        60
     LQRQGYCVNH KRVARLMRQI GIMAKTKVKR KRTTNSEHSF PRYGNRVLNL SIDHPEQVWV       120
     ADITYIRLQQ EFVYLAVVMD VFTRAIRGWH LSRHIDQQLT LRALNKALER ATPEIHHSDQ       180
     GVQYAAAAYM QLLQQHQVQI SMAEVGQAWQ NGYAERLMRT IKEEEVDLSD YRNFTEAYEH       240
     IEQFLEDVYM HKRIHSSLGY LTPCEYEQQW RQQNNHYCMN KEDSA                       285
//

If you have problems or comments...

PBIL Back to PBIL home page