(data stored in ACNUC8465 zone)

EMBL: CP000828.PE594

CP000828.PE594       Location/Qualifiers
FT   CDS             complement(623376..623777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0636"
FT                   /product="universal stress protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25685"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD94"
FT                   /protein_id="ABW25685.1"
FT                   /translation="MFKTILFPIDQSRASQDAAEKVAEIVKFCDSKLIILSVQSDAENT
FT                   PENSTPDNQAIDQLLQNAKIAFSDWGIAAEITKLEGRPAFCICDYADEINADLIVMGCR
FT                   GVGLTEEGAAESVSNRVINLAPCPVMVIP"
     MFKTILFPID QSRASQDAAE KVAEIVKFCD SKLIILSVQS DAENTPENST PDNQAIDQLL        60
     QNAKIAFSDW GIAAEITKLE GRPAFCICDY ADEINADLIV MGCRGVGLTE EGAAESVSNR       120
     VINLAPCPVM VIP                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page