(data stored in ACNUC8465 zone)

EMBL: CP000828.PE599

CP000828.PE599       Location/Qualifiers
FT   CDS             complement(627047..628126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0641"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25690"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD99"
FT                   /protein_id="ABW25690.1"
FT                   /translation="MTVDIEFLIQKEGDFAWLPLESLSVEILVGRYQLIAQTSEADCPI
FT                   QVHIHHQYVEDGLWQEVVQHQLFHTDSQGRIEVLPPTFLQHGRWIISCAANEDEQLANS
FT                   EIDRHCVQLQVLEQETDLDQDWEFLSHSMACQESNGQQADLLAPLQAANIRAKTAWNNI
FT                   APPEESISIPEEEFNLEESIPIPGQEPEETSSISPTLFNIYEPARAANNPEGQPSQDSR
FT                   PESTVPQLPEIPHDITPIRLQISPGLILPPELFTPETDNIPIPQLPEFPHLNQWKDLSY
FT                   SELSVALGRLHWSKLDTYGEAIDVDFGALELQERFLATLTQLSTQKTVNPNNGTSITPE
FT                   KETQSNSKALVPIASEGAS"
     MTVDIEFLIQ KEGDFAWLPL ESLSVEILVG RYQLIAQTSE ADCPIQVHIH HQYVEDGLWQ        60
     EVVQHQLFHT DSQGRIEVLP PTFLQHGRWI ISCAANEDEQ LANSEIDRHC VQLQVLEQET       120
     DLDQDWEFLS HSMACQESNG QQADLLAPLQ AANIRAKTAW NNIAPPEESI SIPEEEFNLE       180
     ESIPIPGQEP EETSSISPTL FNIYEPARAA NNPEGQPSQD SRPESTVPQL PEIPHDITPI       240
     RLQISPGLIL PPELFTPETD NIPIPQLPEF PHLNQWKDLS YSELSVALGR LHWSKLDTYG       300
     EAIDVDFGAL ELQERFLATL TQLSTQKTVN PNNGTSITPE KETQSNSKAL VPIASEGAS        359
//

If you have problems or comments...

PBIL Back to PBIL home page