(data stored in ACNUC8465 zone)

EMBL: CP000828.PE6

CP000828.PE6         Location/Qualifiers
FT   CDS             7272..8051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25097"
FT                   /db_xref="UniProtKB/TrEMBL:B0C4Y5"
FT                   /protein_id="ABW25097.1"
FT                   /translation="MSQVPNLNTLFQSAQADGVLSNASMQALNVVDIGAQIQAGLGTPV
FT                   DDVMASEVVLVTIMPDDSGSIRFAGNGAVVRAGHNMVLDTLAMSPQQDQILVHNRYLNG
FT                   AVLYPYCPVDQALRMDQHNYDPNLGTPLYDQTLVLLATVLAKAQAFIDNGVPARTVSLI
FT                   ITDGADAHSRRSVREVKGVVEDMLRTEDHIIAAMGINDGQTDFKRVFREMGVRDQWILT
FT                   PGNSQNEIRKAFQLFSQSVLRASQSAHNFNSWGGFGP"
     MSQVPNLNTL FQSAQADGVL SNASMQALNV VDIGAQIQAG LGTPVDDVMA SEVVLVTIMP        60
     DDSGSIRFAG NGAVVRAGHN MVLDTLAMSP QQDQILVHNR YLNGAVLYPY CPVDQALRMD       120
     QHNYDPNLGT PLYDQTLVLL ATVLAKAQAF IDNGVPARTV SLIITDGADA HSRRSVREVK       180
     GVVEDMLRTE DHIIAAMGIN DGQTDFKRVF REMGVRDQWI LTPGNSQNEI RKAFQLFSQS       240
     VLRASQSAHN FNSWGGFGP                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page