(data stored in ACNUC27125 zone)

EMBL: CP000828.PE602

CP000828.PE602       Location/Qualifiers
FT   CDS             complement(630056..631414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0644"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25693"
FT                   /db_xref="GOA:B0CE59"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE59"
FT                   /protein_id="ABW25693.1"
FT                   /translation="MNFIVYLVMFGWIPLVLYLFSQLPVQRALVISFIGAWLFLPQASF
FT                   PLVGLPDLTKMSATCYGILLATFIFDAKRFQLFKFSWIDIPMVVWCLCPIASSLTNDLG
FT                   LYDGLAQALGQTVTWGFPYFLGRLYLGNLSGLRQLATGIIIGGILYVPLCLLEIRLSPQ
FT                   LHRWIYGYHAHSFEQTFRLGGFRPTVFMEHGLMLGVWMMSATLMAIWLWRAGTLTRLGD
FT                   IPMIWCVLALGVTFILLRSTGAYALLLISLILLFAVTWSRSSIAIWLLALLMAGYLAIS
FT                   STGSLTPTYTRQLVATASQITGPERAASLNFRLENEQILSAKARIRPIFGWGGWGRARI
FT                   YNDQGQDISVTDSLWIIAFGNHGLVGLVSLMTALVLPILMLARRIPVSNWTHPAAAPVA
FT                   ALSVALIMYGLDCLVNAMINPVFALAAGGLSGLAVQKINRKRLRRPGSQRIAT"
     MNFIVYLVMF GWIPLVLYLF SQLPVQRALV ISFIGAWLFL PQASFPLVGL PDLTKMSATC        60
     YGILLATFIF DAKRFQLFKF SWIDIPMVVW CLCPIASSLT NDLGLYDGLA QALGQTVTWG       120
     FPYFLGRLYL GNLSGLRQLA TGIIIGGILY VPLCLLEIRL SPQLHRWIYG YHAHSFEQTF       180
     RLGGFRPTVF MEHGLMLGVW MMSATLMAIW LWRAGTLTRL GDIPMIWCVL ALGVTFILLR       240
     STGAYALLLI SLILLFAVTW SRSSIAIWLL ALLMAGYLAI SSTGSLTPTY TRQLVATASQ       300
     ITGPERAASL NFRLENEQIL SAKARIRPIF GWGGWGRARI YNDQGQDISV TDSLWIIAFG       360
     NHGLVGLVSL MTALVLPILM LARRIPVSNW THPAAAPVAA LSVALIMYGL DCLVNAMINP       420
     VFALAAGGLS GLAVQKINRK RLRRPGSQRI AT                                     452
//

If you have problems or comments...

PBIL Back to PBIL home page