(data stored in ACNUC8465 zone)

EMBL: CP000828.PE608

CP000828.PE608       Location/Qualifiers
FT   CDS             638044..638604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0650"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25699"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE65"
FT                   /protein_id="ABW25699.1"
FT                   /translation="MQFSGLILSVVIFPLSLVNTSQAQLIIPAGQVQPPPIPAGFTLQD
FT                   ARQQGRQLTIDTRKTIRKLPENFKTTRTPIIWLSCNPGGLEENNVLVIHSPILIHLSEV
FT                   LLTEKAIWHDTRSPLELKQIPIKGFSEYFSKHSRKLGDQSISPHITQATQWIRTKDNKM
FT                   KLIYGGVRPLPSSQTSSRPCRKK"
     MQFSGLILSV VIFPLSLVNT SQAQLIIPAG QVQPPPIPAG FTLQDARQQG RQLTIDTRKT        60
     IRKLPENFKT TRTPIIWLSC NPGGLEENNV LVIHSPILIH LSEVLLTEKA IWHDTRSPLE       120
     LKQIPIKGFS EYFSKHSRKL GDQSISPHIT QATQWIRTKD NKMKLIYGGV RPLPSSQTSS       180
     RPCRKK                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page