(data stored in ACNUC27125 zone)

EMBL: CP000828.PE610

CP000828.PE610       Location/Qualifiers
FT   CDS             640096..641094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0653"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase 3"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0653"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25701"
FT                   /db_xref="GOA:B0CE67"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0CE67"
FT                   /protein_id="ABW25701.1"
FT                   /translation="MQQMATGLAVTGCGSAAPETSLDNHGLSQIVDTSDEWIASRTGIR
FT                   SRHLAGPDDTLAKLGAIAAQNALEMAQVEATDLDLILLATSTPDDLFGSACQIQAAIGA
FT                   KHAVAFDLTAACSGFVFGMITAAQFIRTGVYRNVLLVGADVLSRWVDWTDRRSCVLFGD
FT                   GAGAVVLQANDTDRLLGFALHSDGCLHDCLNVQYQGEARPLTGEINVSQGTYQPISMNG
FT                   KEVYRFAVNRVPEVVEKALFQSDLKTDDIDWLLLHQANQRILDAVAKRLKVPAEKVISN
FT                   IANYGNTSAATIPLALDATVRKGHIKPGDTIAASGFGAGLSWGAAIFQWQR"
     MQQMATGLAV TGCGSAAPET SLDNHGLSQI VDTSDEWIAS RTGIRSRHLA GPDDTLAKLG        60
     AIAAQNALEM AQVEATDLDL ILLATSTPDD LFGSACQIQA AIGAKHAVAF DLTAACSGFV       120
     FGMITAAQFI RTGVYRNVLL VGADVLSRWV DWTDRRSCVL FGDGAGAVVL QANDTDRLLG       180
     FALHSDGCLH DCLNVQYQGE ARPLTGEINV SQGTYQPISM NGKEVYRFAV NRVPEVVEKA       240
     LFQSDLKTDD IDWLLLHQAN QRILDAVAKR LKVPAEKVIS NIANYGNTSA ATIPLALDAT       300
     VRKGHIKPGD TIAASGFGAG LSWGAAIFQW QR                                     332
//

If you have problems or comments...

PBIL Back to PBIL home page