(data stored in ACNUC27125 zone)

EMBL: CP000828.PE616

CP000828.PE616       Location/Qualifiers
FT   CDS             complement(644241..645080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0659"
FT                   /product="SWIM zinc finger domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0659"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25707"
FT                   /db_xref="GOA:B0CE73"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE73"
FT                   /protein_id="ABW25707.1"
FT                   /translation="MANFSRTWWGQRFLTAIEQITDPGRLGRGRSYARGNKVKSFTLKD
FT                   GLVKAEVRGSVNPYFGVYKEPLYETSIEFEPISKANWAAAIAFIASKASLISRLMLNEM
FT                   PDNIEDAFAKLDLNLLPRSNTNFKTQCSCPDWSNPCKHIAGVYYLLAAELDQDPFLLFE
FT                   LRGLSRENLQKELAKSPLGQALSAELTAQQTELEPDTSYYTQPLTTPASEIEQLKDFWQ
FT                   GDKRLPQTINAPPSTGVSGILVKTQGDFPAFWPKEQSFLAVMEEFYDRVRDKSSAVL"
     MANFSRTWWG QRFLTAIEQI TDPGRLGRGR SYARGNKVKS FTLKDGLVKA EVRGSVNPYF        60
     GVYKEPLYET SIEFEPISKA NWAAAIAFIA SKASLISRLM LNEMPDNIED AFAKLDLNLL       120
     PRSNTNFKTQ CSCPDWSNPC KHIAGVYYLL AAELDQDPFL LFELRGLSRE NLQKELAKSP       180
     LGQALSAELT AQQTELEPDT SYYTQPLTTP ASEIEQLKDF WQGDKRLPQT INAPPSTGVS       240
     GILVKTQGDF PAFWPKEQSF LAVMEEFYDR VRDKSSAVL                              279
//

If you have problems or comments...

PBIL Back to PBIL home page