(data stored in ACNUC27125 zone)

EMBL: CP000828.PE62

CP000828.PE62        Location/Qualifiers
FT   CDS             complement(62478..62795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0065"
FT                   /product="cupin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25153"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B0C541"
FT                   /protein_id="ABW25153.1"
FT                   /translation="MNNIFAELPDNLEQEVFETLISNDGVKVERIISKGHKTEAGQWYD
FT                   QDLNEWVMVLKGAARLVFEGGESVELNEGSYINIPAHQKHRVDWTDPTQETIWLAIHYS
FT                   E"
     MNNIFAELPD NLEQEVFETL ISNDGVKVER IISKGHKTEA GQWYDQDLNE WVMVLKGAAR        60
     LVFEGGESVE LNEGSYINIP AHQKHRVDWT DPTQETIWLA IHYSE                       105
//

If you have problems or comments...

PBIL Back to PBIL home page