(data stored in ACNUC5340 zone)

EMBL: CP000828.PE622

CP000828.PE622       Location/Qualifiers
FT   CDS             652153..652407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0665"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0665"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25713"
FT                   /db_xref="GOA:B0CE79"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE79"
FT                   /protein_id="ABW25713.1"
FT                   /translation="MIIPGVAGVVIFGNAALTDWQQLRIDYRAYEDVLRSTDDLSTLFK
FT                   AEAAQNIQRINLFADGVWTLLSGILGAIGLHGWLSNTKS"
     MIIPGVAGVV IFGNAALTDW QQLRIDYRAY EDVLRSTDDL STLFKAEAAQ NIQRINLFAD        60
     GVWTLLSGIL GAIGLHGWLS NTKS                                               84
//

If you have problems or comments...

PBIL Back to PBIL home page