(data stored in ACNUC5340 zone)

EMBL: CP000828.PE623

CP000828.PE623       Location/Qualifiers
FT   CDS             652404..653033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0666"
FT                   /product="binding-protein-dependent inner membrane
FT                   transport system, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0666"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25714"
FT                   /db_xref="GOA:B0CE80"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE80"
FT                   /protein_id="ABW25714.1"
FT                   /translation="MSYILQNPDLVLELLLEHLQMTGIALAGAVIIAVPIAWIIYRWTW
FT                   LQGPIMAVLGVIYTIPSLALMILLIPLLGLSSMTAIVAMTLYAQVILVRSILVGLQSIP
FT                   QPILEAAQGMGMSAWQCWWQVQVPLMRPVFLAGVRLATTVMIALGTIAAKFGAGGLGVL
FT                   LFEGIAQAGRYDKIWAGTIVVGLLAVISNGLLWLWEQQLQPKSPPA"
     MSYILQNPDL VLELLLEHLQ MTGIALAGAV IIAVPIAWII YRWTWLQGPI MAVLGVIYTI        60
     PSLALMILLI PLLGLSSMTA IVAMTLYAQV ILVRSILVGL QSIPQPILEA AQGMGMSAWQ       120
     CWWQVQVPLM RPVFLAGVRL ATTVMIALGT IAAKFGAGGL GVLLFEGIAQ AGRYDKIWAG       180
     TIVVGLLAVI SNGLLWLWEQ QLQPKSPPA                                         209
//

If you have problems or comments...

PBIL Back to PBIL home page