(data stored in ACNUC27125 zone)

EMBL: CP000828.PE624

CP000828.PE624       Location/Qualifiers
FT   CDS             653201..654508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0667"
FT                   /product="DnaJ domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25715"
FT                   /db_xref="GOA:B0CE81"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE81"
FT                   /protein_id="ABW25715.1"
FT                   /translation="MADLQPYFQLLRVSADVTPAELKAAFRRQARTCHPDLHPDNPAAE
FT                   AEFQRLSEAYDIISEALYPPSPVDGFIHGDGSNGLTNAQALYARGTQKAAERDYIGAIQ
FT                   DYTRAIESDPEFLDAYLKRCQVRFVQGDDEGVLAECAEILGLDDTVAQAYYYQGRARLQ
FT                   LGSAPAAIASYSQAISLDEDYAQAWLHRGRARLEMQEETLAREDLTKAAQLFEAQGEPD
FT                   EVNRVQVILQEMGRSRRSKSEVKVQRQQLREQGLLQDIFTTIPEFFMNPSGGLLPTFAR
FT                   LSARRATEVGLSYAGLSILGFVLAANLFPIVFSSVTLGERFILGAMPFFSLVFLNQLVR
FT                   SLIRARGSWASDIFISGATLLPLSLLMFLSGLVVQFGAAGVWILSFYLGCDSVLMLYVG
FT                   CSQVNNLSEQNATLAVPTLLLITSALTYGTFTIFAS"
     MADLQPYFQL LRVSADVTPA ELKAAFRRQA RTCHPDLHPD NPAAEAEFQR LSEAYDIISE        60
     ALYPPSPVDG FIHGDGSNGL TNAQALYARG TQKAAERDYI GAIQDYTRAI ESDPEFLDAY       120
     LKRCQVRFVQ GDDEGVLAEC AEILGLDDTV AQAYYYQGRA RLQLGSAPAA IASYSQAISL       180
     DEDYAQAWLH RGRARLEMQE ETLAREDLTK AAQLFEAQGE PDEVNRVQVI LQEMGRSRRS       240
     KSEVKVQRQQ LREQGLLQDI FTTIPEFFMN PSGGLLPTFA RLSARRATEV GLSYAGLSIL       300
     GFVLAANLFP IVFSSVTLGE RFILGAMPFF SLVFLNQLVR SLIRARGSWA SDIFISGATL       360
     LPLSLLMFLS GLVVQFGAAG VWILSFYLGC DSVLMLYVGC SQVNNLSEQN ATLAVPTLLL       420
     ITSALTYGTF TIFAS                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page