(data stored in ACNUC8465 zone)

EMBL: CP000828.PE626

CP000828.PE626       Location/Qualifiers
FT   CDS             complement(656204..656329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0669"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25717"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE83"
FT                   /protein_id="ABW25717.1"
FT                   /translation="MRFPVFLRRSLVYISAKNSCVVPSHECHIPLITIFIVTPLG"
     MRFPVFLRRS LVYISAKNSC VVPSHECHIP LITIFIVTPL G                            41
//

If you have problems or comments...

PBIL Back to PBIL home page