(data stored in ACNUC8465 zone)

EMBL: CP000828.PE627

CP000828.PE627       Location/Qualifiers
FT   CDS             656620..657117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25718"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE84"
FT                   /protein_id="ABW25718.1"
FT                   /translation="MFLVFFLVSTITVLLMKLPFLKSQRFLSSALAACLVGILLFGNSV
FT                   AALTLNLPQLAAMGASDSALDQRQRVIDEDLKIDPTKLRYRGLEYVQFQPEAERLTDPE
FT                   IKSLIKSDINPEVFAAVASGSVQIFGNVQDIDIARDIVTQIKDIPGVREVMFDIGLEVK
FT                   AE"
     MFLVFFLVST ITVLLMKLPF LKSQRFLSSA LAACLVGILL FGNSVAALTL NLPQLAAMGA        60
     SDSALDQRQR VIDEDLKIDP TKLRYRGLEY VQFQPEAERL TDPEIKSLIK SDINPEVFAA       120
     VASGSVQIFG NVQDIDIARD IVTQIKDIPG VREVMFDIGL EVKAE                       165
//

If you have problems or comments...

PBIL Back to PBIL home page