(data stored in ACNUC27125 zone)

EMBL: CP000828.PE629

CP000828.PE629       Location/Qualifiers
FT   CDS             658028..658222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0673"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0673"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25720"
FT                   /db_xref="GOA:B0CE86"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE86"
FT                   /protein_id="ABW25720.1"
FT                   /translation="MSFASLGSPKADKTLQTLFFCPNVEETAGLAIRPHTFWADILVIL
FT                   MQLLMLSSLTALRSTGRRD"
     MSFASLGSPK ADKTLQTLFF CPNVEETAGL AIRPHTFWAD ILVILMQLLM LSSLTALRST        60
     GRRD                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page