(data stored in ACNUC8465 zone)

EMBL: CP000828.PE63

CP000828.PE63        Location/Qualifiers
FT   CDS             complement(62815..63222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0066"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25154"
FT                   /db_xref="GOA:B0C542"
FT                   /db_xref="UniProtKB/TrEMBL:B0C542"
FT                   /protein_id="ABW25154.1"
FT                   /translation="MKPCRECQAQISEQALTCPQCGAPYPARTSWDGWGFEYKSSLMIA
FT                   GLPLVHIAFKYRPNRRPVLAKGVIAIGQFGYGVICISQVGVGLISLSQFTLAGFALAQF
FT                   AVAYSLVAQFGIYWAEGRGQWVFKFAELLGF"
     MKPCRECQAQ ISEQALTCPQ CGAPYPARTS WDGWGFEYKS SLMIAGLPLV HIAFKYRPNR        60
     RPVLAKGVIA IGQFGYGVIC ISQVGVGLIS LSQFTLAGFA LAQFAVAYSL VAQFGIYWAE       120
     GRGQWVFKFA ELLGF                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page