(data stored in ACNUC8465 zone)

EMBL: CP000828.PE631

CP000828.PE631       Location/Qualifiers
FT   CDS             661708..662181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0674"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0674"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25722"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE88"
FT                   /protein_id="ABW25722.1"
FT                   /translation="MRETVYIETSILGYLTARRSRDIIVMANIEITREWWDARRPDFQL
FT                   YSSQAVVQETTQGDAEIAAQRLDILSDISLLDLDQAVLELATAFLERSNLPAKANVDAI
FT                   HIAVATVHGMDYVLTWNCKHIANAQIQRKLAEVSLALGYALPILCTPYELLGG"
     MRETVYIETS ILGYLTARRS RDIIVMANIE ITREWWDARR PDFQLYSSQA VVQETTQGDA        60
     EIAAQRLDIL SDISLLDLDQ AVLELATAFL ERSNLPAKAN VDAIHIAVAT VHGMDYVLTW       120
     NCKHIANAQI QRKLAEVSLA LGYALPILCT PYELLGG                                157
//

If you have problems or comments...

PBIL Back to PBIL home page