(data stored in ACNUC5340 zone)

EMBL: CP000828.PE634

CP000828.PE634       Location/Qualifiers
FT   CDS             complement(664001..664228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0677"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0677"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25725"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE91"
FT                   /protein_id="ABW25725.1"
FT                   /translation="MYSINLQKAEHQLAKLIDDAARGKNVIITRDDGTSFQLIPFKPKT
FT                   AIPTFGSAKGLIKIADNFGDPIEGFEEYTP"
     MYSINLQKAE HQLAKLIDDA ARGKNVIITR DDGTSFQLIP FKPKTAIPTF GSAKGLIKIA        60
     DNFGDPIEGF EEYTP                                                         75
//

If you have problems or comments...

PBIL Back to PBIL home page