(data stored in ACNUC8465 zone)

EMBL: CP000828.PE638

CP000828.PE638       Location/Qualifiers
FT   CDS             complement(667952..668323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0680"
FT                   /product="type I restriction-modification system, M
FT                   subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0680"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25729"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:B0CE95"
FT                   /protein_id="ABW25729.1"
FT                   /translation="MITGEIKSKVDKIWDTMWSGGISNPLSVIEQLTYLLFIKQLDEQH
FT                   TRKESKANRSGKPIEEPIFAPEQDHLRWSRFKETAPEQMFETLRDEVFPFIKTLGQTDS
FT                   GENGEEDSTYSHHIPLLSL"
     MITGEIKSKV DKIWDTMWSG GISNPLSVIE QLTYLLFIKQ LDEQHTRKES KANRSGKPIE        60
     EPIFAPEQDH LRWSRFKETA PEQMFETLRD EVFPFIKTLG QTDSGENGEE DSTYSHHIPL       120
     LSL                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page