(data stored in ACNUC27125 zone)

EMBL: CP000828.PE646

CP000828.PE646       Location/Qualifiers
FT   CDS             671989..672132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0691"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0691"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25737"
FT                   /db_xref="UniProtKB/TrEMBL:B0CEA3"
FT                   /protein_id="ABW25737.1"
FT                   /translation="MTVRWRQLLVSLSLWLLAELVLNWVGIDDLVDYSEYLFERQAIVF
FT                   YV"
     MTVRWRQLLV SLSLWLLAEL VLNWVGIDDL VDYSEYLFER QAIVFYV                      47
//

If you have problems or comments...

PBIL Back to PBIL home page