(data stored in ACNUC27125 zone)

EMBL: CP000828.PE650

CP000828.PE650       Location/Qualifiers
FT   CDS             complement(675785..677212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="AM1_0695"
FT                   /product="protein-export membrane protein SecD"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0695"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25741"
FT                   /db_xref="GOA:B0CEA7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/Swiss-Prot:B0CEA7"
FT                   /protein_id="ABW25741.1"
FT                   /translation="MLKQQRFLLALIALLVVGALIVVTPFGKQYGLGKINLGLDLRGGS
FT                   QLTLQVNPTEEVKDITPNVMEAVQTVVANRLNPEGVSEIVVQTVGSQQILVQLPGVSDP
FT                   KDAEQLLSQVAQLDFRRPNNAILAQVNVRSSELQRLLQKLPEAEKAGDAAALAKLQGEV
FT                   QQKQKQLTELQDQFFVKTDLTGEDLNDAGYAISQSQPNKWDVTLRFDVDGGKKFAALTK
FT                   SLAGTGQPLGIFLDGKSISQATVSDRFKANGITGGAAIITGNFELEDAKLLANQLKGGS
FT                   LPVPVKVEEIRTVGATLGQDSIRQSVYAGIGGLILVLIFMGVWYRLPGLIADVALCVYG
FT                   LLTFACYVLFGVTLTLPGIAGFILSIGMAVDANILIFERTREELRSGKTLYRSIESGFY
FT                   RAFTSILDSNVTTLIACGVLYWLGSGLVRGFAVTLGIGVAVSMFTAITCSRTLMFTAIS
FT                   LPNLRKIELFDSKRAVS"
     MLKQQRFLLA LIALLVVGAL IVVTPFGKQY GLGKINLGLD LRGGSQLTLQ VNPTEEVKDI        60
     TPNVMEAVQT VVANRLNPEG VSEIVVQTVG SQQILVQLPG VSDPKDAEQL LSQVAQLDFR       120
     RPNNAILAQV NVRSSELQRL LQKLPEAEKA GDAAALAKLQ GEVQQKQKQL TELQDQFFVK       180
     TDLTGEDLND AGYAISQSQP NKWDVTLRFD VDGGKKFAAL TKSLAGTGQP LGIFLDGKSI       240
     SQATVSDRFK ANGITGGAAI ITGNFELEDA KLLANQLKGG SLPVPVKVEE IRTVGATLGQ       300
     DSIRQSVYAG IGGLILVLIF MGVWYRLPGL IADVALCVYG LLTFACYVLF GVTLTLPGIA       360
     GFILSIGMAV DANILIFERT REELRSGKTL YRSIESGFYR AFTSILDSNV TTLIACGVLY       420
     WLGSGLVRGF AVTLGIGVAV SMFTAITCSR TLMFTAISLP NLRKIELFDS KRAVS            475
//

If you have problems or comments...

PBIL Back to PBIL home page